PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A02565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 294aa    MW: 32832.5 Da    PI: 5.4306
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A02565.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92.1e-171676148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.............TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.............kgRtlkqcksrwqkyl 48
                     +g+WT++Ed+llv++v+q+G g+W+++a+  g             ++R++k+c++rw +yl
   Pahal.A02565.1 16 KGPWTAQEDKLLVEYVRQHGEGRWNSVAKLTGtdqtlvadplsfgLKRSGKSCRLRWVNYL 76
                     79*********************************************************97 PP

2Myb_DNA-binding50.93.6e-1682126147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
   Pahal.A02565.1  82 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 126
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3641176IPR017930Myb domain
SuperFamilySSF466891.16E-2814123IPR009057Homeodomain-like
SMARTSM007172.1E-151578IPR001005SANT/Myb domain
PfamPF002498.1E-171676IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-231783IPR009057Homeodomain-like
CDDcd001675.35E-111876No hitNo description
PROSITE profilePS5129424.93377131IPR017930Myb domain
SMARTSM007174.5E-1581129IPR001005SANT/Myb domain
PfamPF002496.4E-1482126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2484129IPR009057Homeodomain-like
CDDcd001677.59E-1086127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEGQFGWGRE EGGWRKGPWT AQEDKLLVEY VRQHGEGRWN SVAKLTGTDQ TLVADPLSFG  60
LKRSGKSCRL RWVNYLRPDL KRGKITPQEE SVILELHALW GNRWSTIARS LPGRTDNEIK  120
NYWRTHFKKG KPSKNIERAR ARFLKQRREM QSQLLLQQQQ GQDQQQRQRQ AGDDHDDGAV  180
TREASSSPAV SLAAQHEEDL QMLQQDMDDL LFQFCCPMAS SSCLLPGAAA AASASASEEG  240
STGDHPQLDE GATWGWGTLW NLDDVADDVD GGACGGWDTS LFPLLQDQGL AFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24161297106B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-97AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-97AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454181.11e-141hypothetical protein SORBIDRAFT_04g026210
TrEMBLC5XXQ51e-141C5XXQ5_SORBI; Putative uncharacterized protein Sb04g026210
STRINGSb04g026210.11e-141(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.18e-62myb domain protein 79